SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000439438 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000439438
Domain Number 1 Region: 59-94
Classification Level Classification E-value
Superfamily RNI-like 0.000000608
Family 28-residue LRR 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000439438   Gene: ENSG00000151743   Transcript: ENST00000506446
Sequence length 105
Comment pep:putative chromosome:GRCh37:12:31854802:31867885:-1 gene:ENSG00000151743 transcript:ENST00000506446 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKNISRYLTDIKPLPPNIKDRLIKIMSMQGQITDSNISEGHAPLPRLEYSGAISAHCNLR
CLDLVQTLDLRSCDISDAALLHLSNCRKLKKLNLNASKGNRVSVT
Download sequence
Identical sequences F5H286
ENSP00000439438

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]