SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000439805 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000439805
Domain Number 1 Region: 1-62
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.2e-26
Family KRAB domain (Kruppel-associated box) 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000439805   Gene: ENSG00000196387   Transcript: ENST00000440984
Sequence length 108
Comment pep:putative chromosome:GRCh37:12:133657502:133660792:1 gene:ENSG00000196387 transcript:ENST00000440984 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQGSVTFRDVAIDFSQEEWKWLQPAQRDLYRCVMLENYGHLVSLGLSISKPDVVSLLEQ
GKEPWLGKREVKRDLFSGVFFVPIVSSVWSLNFISFCFFFPFFLQMDI
Download sequence
Identical sequences ENSP00000439805

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]