SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000439806 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000439806
Domain Number 1 Region: 412-468
Classification Level Classification E-value
Superfamily UBA-like 0.0000000000319
Family UBA domain 0.00014
Further Details:      
 
Domain Number 2 Region: 483-534
Classification Level Classification E-value
Superfamily UBA-like 0.0000357
Family UBA domain 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000439806   Gene: ENSG00000165006   Transcript: ENST00000543944
Sequence length 538
Comment pep:known chromosome:GRCh37:9:34179003:34252521:1 gene:ENSG00000165006 transcript:ENST00000543944 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGAVRGRRREVGLQHGGCGTGGGYGDGLARSGQSWRWWRSLSLGAVGSSAGTEPGRPAG
ASTFRLLRRRQQRHSGSKWLLRSWVQIFMYDFSLEKKTIEWAEEIKKIEEAEREAECKIA
EAEAKVNSKSGPEGDSKMSFSKTHSTATMPPPINPILASLQHNSILTPTRVSSSATKQKV
LSPPHIKADFNLADFECEEDPFDNLELKTIDEKEELRNILVGTTGPIMAQLLDNNLPRGG
SGSVLQDEEVLASLERATLDFKPLHKPNGFITLPQLGNCEKMSLSSKVSLPPIPAVSNIK
SLSFPKLDSDDSNQKTAKLASTFHSTSCLRNGTFQNSLKPSTQSSASELNGHHTLGLSAL
NLDSGTEMPALTSSQMPSLSVLSVCTEESSPPNTGPTVTPPNFSVSQVPNMPSCPQAYSE
LQMLSPSERQCVETVVNMGYSYECVLRAMKKKGENIEQILDYLFAHGQLCEKGFDPLLVE
EALEMHQCSEEKMMEFLQLMSKFKEMGFELKDIKEVLLLHNNDQDNALEDLMARAGAS
Download sequence
Identical sequences ENSP00000439806 NP_001164673.1.87134 NP_001164673.1.92137 gi|283945560|ref|NP_001164673.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]