SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000440089 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000440089
Domain Number 1 Region: 1-341
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.28e-132
Family GABA-aminotransferase-like 0.00000000000655
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000440089   Gene: ENSG00000176974   Transcript: ENST00000539052
Sequence length 345
Comment pep:known chromosome:GRCh37:17:18231784:18266809:-1 gene:ENSG00000176974 transcript:ENST00000539052 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLDLPDGGHLTHGFMTDKKKISATSIFFESMPYKVNPDTGYINYDQLEENARLFHPKLI
IAGTSCYSRNLEYARLRKIADENGAYLMADMAHISGLVAAGVVPSPFEHCHVVTTTTHKT
LRGCRAGMIFYRKGVKSVDPKTGKEILYNLESLINSAVFPGLQGGPHNHAIAGVAVALKQ
AMTLEFKVYQHQVVANCRALSEALTELGYKIVTGGSDNHLILVDLRSKGTDGGRAEKVLE
ACSIACNKNTCPGDRSALRPSGLRLGTPALTSRGLLEKDFQKVAHFIHRGIELTLQIQSD
TGVRATLKEFKERLAGDKYQAAVQALREEVESFASLFPLPGLPDF
Download sequence
Identical sequences ENSP00000345881 ENSP00000440089 NP_001268715.1.87134 NP_001268715.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]