SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000440153 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000440153
Domain Number 1 Region: 2-234,283-367
Classification Level Classification E-value
Superfamily RNI-like 3.93e-41
Family 28-residue LRR 0.011
Further Details:      
 
Domain Number 2 Region: 383-585
Classification Level Classification E-value
Superfamily RNI-like 6.47e-18
Family 28-residue LRR 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000440153   Gene: ENSG00000140853   Transcript: ENST00000543030
Sequence length 631
Comment pep:putative chromosome:GRCh37:16:57060791:57095878:1 gene:ENSG00000140853 transcript:ENST00000543030 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LTCTDLATLTNILEHREAPIHLDFDGCPLEPHCPEALVGCGQIENLSFKSRKCGDAFAEA
LSRSLPTMGRLQMLGLSSNSICVSTLLCLARVAVTCPTVRMLQAREADLIFLLSPPTETT
AELQRAPDLQESDGQRKGAQSRSLTLRLQKCQLQVHDAEALIALLQEGPHLEEVDLSGNQ
LEDEGCRLMAEAASQLHIARKLDLSNNGLSVAGVHCVLRAVSACWTLAELHISLQHKTVI
FMFAQEPEEQKGPQERAAFLDSLMLQMPSELPLSSRRMRLTHCGLQEKHLEQLCKALGGS
CHLGHLHLDFSGNALGDEGAARLAQLLPGLGALQSLNLSENGLSLDAVLGLVRCFSTLQW
LFRLDISFESQHILLRGDKTSSLSECPLEPPSLTRLCATLKDCPGPLELQLSCEFLSDQS
LETLLDCLPQLPQLSLLQLSQTGLSPKSPFLLANTLSLCPRVKKVDLRSLHHATLHFRSN
EEEEGVCCGRFTGCSLSQEHVESLCWLLSKCKDLSQVDLGSEQSFRIHFSREDQAGKTLR
LSECSFRPEHVSRLATGLSKSLQLTELTLTQCCLGQKQLAILLSLVGRPAGLFSLRDSTR
HTEKLSFPTLEACALGFKKKRKKERKKVSED
Download sequence
Identical sequences H0YFT1
ENSP00000440153 ENSP00000440153

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]