SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000440184 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000440184
Domain Number 1 Region: 2-139
Classification Level Classification E-value
Superfamily RNI-like 0.0000000000000628
Family Rna1p (RanGAP1), N-terminal domain 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000440184   Gene: ENSG00000140853   Transcript: ENST00000399221
Sequence length 157
Comment pep:putative chromosome:GRCh37:16:57091977:57095915:1 gene:ENSG00000140853 transcript:ENST00000399221 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XLSANLLGDSGLRCLLECLPQVPISGLLDLSHNSISQESALYLLETLPSCPRVREASVNL
GSEQSFRIHFSREDQAGKTLRLSECSFRPEHVSRLATGLSKSLQLTELTLTQCCLGQKQL
AILLSLVGRPAGLFSLRLHKAHRETVLPHTGGLCFGI
Download sequence
Identical sequences H0YFT3
ENSP00000440184 ENSP00000440184

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]