SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000440190 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000440190
Domain Number 1 Region: 648-704
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0000000000000165
Family Tudor domain 0.0000529
Further Details:      
 
Domain Number 2 Region: 283-337
Classification Level Classification E-value
Superfamily UBA-like 0.0000000000105
Family UBA domain 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000440190   Gene: ENSG00000083544   Transcript: ENST00000535286
Sequence length 744
Comment pep:known chromosome:GRCh37:13:60971427:61148012:1 gene:ENSG00000083544 transcript:ENST00000535286 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQVAGAALSQAGWYLSDEGIEACTSSPDKVNVNDIILIALNTDLRTIGKKFLPSDINSG
KVEKLEGPCVLQIQKIRNVAAPKDNEESQAAPRMLRLQMTDGHISCTAVEFSYMSKISLN
TPPGTKVKLSGIVDIKNGFLLLNDSNTTVLGGEVEHLIEKWELQRSLSKHNRSNIGTEGG
PPPFVPFGQKCVSHVQVDSRELDRRKTLQVTMPVKPTNDNDEFEKQRTAAIAEVAKSKET
KTFGGGGGGARSNLNMNAAGNRNREVLQKEKSTKSEGKHEGVYRELVDEKALKHITEMGF
SKEASRQALMDNGNNLEAALNVLLTSNKQKPVMGPPLRGRGKGRGRIRSEDEEDLGNARP
SAPSTLFDFLESKMGTLNVEEPKSQPQQLHQGQYRSSNTEQNGVKDNNHLRHPPRNDTRQ
PRNEKPPRFQRDSQNSKSVLEGSGLPRNRGSERPSTSSVSEVWAEDRIKCDRPYSRYDRT
KDTSYPLGSQHSDGAFKKRDNSMQSRSGKGPSFAEAKENPLPQGSVDYNNQKRGKRESQT
SIPDYFYDRKSQTINNEAFSGIKIEKHFNVNTDYQNPVRSNSFIGVPNGEVEMPLKGRRI
GPIKPAGPVTAVPCDDKIFYNSGPKRRSGPIKPEKILESSIPMEYAKMWKPGDECFALYW
EDNKFYRAEVEALHSSGMTAVVKFIDYGNYEEVLLSNIKPIQTEAWEEEGTYDQTLEFRR
GGDGQPRRSTRPTQQFYQPPRARN
Download sequence
Identical sequences NP_001139542.1.87134 NP_001139542.1.92137 XP_016876266.1.92137 gi|225703106|ref|NP_001139542.1| ENSP00000367114 ENSP00000440190 ENSP00000440190

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]