SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000440294 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000440294
Domain Number - Region: 150-183
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000168
Family EGF-type module 0.018
Further Details:      
 
Domain Number - Region: 179-213
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.000216
Family TB module/8-cys domain 0.011
Further Details:      
 
Domain Number - Region: 116-150
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00838
Family EGF-type module 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000440294   Gene: ENSG00000166147   Transcript: ENST00000537463
Sequence length 302
Comment pep:known chromosome:GRCh37:15:48722961:48937906:-1 gene:ENSG00000166147 transcript:ENST00000537463 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MRRGRLLEIALGFTVLLASYTSHGADANLEAGNVKETRASRAKRRGGGGHDALKGPNVCG
SRYNAYCCPGWKTLPGGNQCIVPICRHSCGDGFCSRPNMCTCPSGQIAPSCGSRSIQHCN
IRCMNGGSCSDDHCLCQKGYIGTHCGQPVCESGCLNGGRCVAPNRCACTYGFTGPQCERD
YRTGPCFTVISNQMCQGQLSGIVCTKTLCCATTSMNVKLEHTTVANMLYVPIQQEASNVA
AVPGGLEMALSALIWTNVPMEPICAASMQTARIPWDLTAVCARKDTQVMASLVQTLMSAL
RT
Download sequence
Identical sequences F6U495
ENSP00000440294 ENSP00000440294

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]