SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000440401 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000440401
Domain Number 1 Region: 467-675
Classification Level Classification E-value
Superfamily RNI-like 3.73e-17
Family 28-residue LRR 0.02
Further Details:      
 
Weak hits

Sequence:  ENSP00000440401
Domain Number - Region: 31-74
Classification Level Classification E-value
Superfamily PH domain-like 0.000632
Family Pleckstrin-homology domain (PH domain) 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000440401   Gene: ENSG00000153815   Transcript: ENST00000539778
Sequence length 679
Comment pep:known chromosome:GRCh37:16:81528954:81745173:1 gene:ENSG00000153815 transcript:ENST00000539778 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQAAEPTGYMENSVSYSAIEDVQLLSWENAPKYCLQLTIPGGTVLLQAANSYLRDQWFH
SLQWKKKIYKYKKVLSNPSRWEVVLKEIRTLVDMALTSPLQDDSINQAPLEIVSKLLSEN
TNLTTQEHENIIVAIAPLLENNHPPPDLCEFFCKHCRERPRSMVVIEVFTPVVQRILKHN
MDFGKCPRLRLFTQEYILALNELNAGMEVVKKFIQSMHGPTGHCPHPRVLPNLVAVCLAA
IYSCYEEFINSRDNSPSLKEIRNGCQQPCDRKPTLPLRLLHPSPDLVSQEATLSEARLKS
VVVASSEIHVEVERTSTAKPALTASAGNDSEPNLIDCLMVSPACSTMSIELGPQADRTLG
CYVEILKLLSDYDDWRPSLASLLQPIPFPKEALAHEKFTKELKYVIQRFAEDPRQEVHSC
LLSVRAGKDGWFQLYSPGGVACDDDGELFASMVHILMGSCYKTKKFLLSLAENKLGPCML
LALRGNQTMVEILCLMLEYNIIDNNDTQLQIISTLESTDVGKRMYEQLCDRQRELKELQR
KGGPTRLTLPSKSTDADLARLLSSGSFGNLENLSLAFTNVTSACAEHLIKLPSLKQLNLW
STQFGDAGLRLLSEHLTMLQVLNLCETPVTDAGLLALSSMKSLCSLNMNSTKLSADTYED
LKAKLPNLKEVDVRYTEAW
Download sequence
Identical sequences A0A2J8LEI2 A0A2J8TA10 G3QCT6
ENSP00000440401 ENSP00000440401 NP_085132.1.87134 NP_085132.1.92137 gi|29789255|ref|NP_085132.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]