SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000440456 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000440456
Domain Number 1 Region: 376-432
Classification Level Classification E-value
Superfamily UBA-like 0.0000000000294
Family UBA domain 0.00014
Further Details:      
 
Domain Number 2 Region: 447-498
Classification Level Classification E-value
Superfamily UBA-like 0.0000321
Family UBA domain 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000440456   Gene: ENSG00000165006   Transcript: ENST00000536252
Sequence length 502
Comment pep:known chromosome:GRCh37:9:34179003:34252521:1 gene:ENSG00000165006 transcript:ENST00000536252 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASKKLGADFHGTFSYLDDVPFKTGDKFKTPAKVGLPIGFSLPDCLQVVREVQYDFSLEK
KTIEWAEEIKKIEEAEREAECKIAEAEAKVNSKSGPEGDSKMSFSKTHSTATMPPPINPI
LASLQHNSILTPTRVSSSATKQKVLSPPHIKADFNLADFECEEDPFDNLELKTIDEKEEL
RNILVGTTGPIMAQLLDNNLPRGGSGSVLQDEEVLASLERATLDFKPLHKPNGFITLPQL
GNCEKMSLSSKVSLPPIPAVSNIKSLSFPKLDSDDSNQKTAKLASTFHSTSCLRNGTFQN
SLKPSTQSSASELNGHHTLGLSALNLDSGTEMPALTSSQMPSLSVLSVCTEESSPPNTGP
TVTPPNFSVSQVPNMPSCPQAYSELQMLSPSERQCVETVVNMGYSYECVLRAMKKKGENI
EQILDYLFAHGQLCEKGFDPLLVEEALEMHQCSEEKMMEFLQLMSKFKEMGFELKDIKEV
LLLHNNDQDNALEDLMARAGAS
Download sequence
Identical sequences Q9NZ09
ENSP00000297661 ENSP00000352541 ENSP00000297661 ENSP00000352541 ENSP00000439976 ENSP00000440456 NP_001164674.1.87134 NP_001164674.1.92137 NP_001164675.1.87134 NP_001164675.1.92137 NP_057609.2.87134 NP_057609.2.92137 XP_006716842.1.92137 XP_011516201.1.92137 XP_016870290.1.92137 gi|283945562|ref|NP_001164674.1| gi|283945566|ref|NP_001164675.1| gi|8394499|ref|NP_057609.2| 9606.ENSP00000297661

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]