SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000440967 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000440967
Domain Number 1 Region: 43-224
Classification Level Classification E-value
Superfamily RNI-like 5.69e-28
Family 28-residue LRR 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000440967   Gene: ENSG00000151743   Transcript: ENST00000536761
Sequence length 240
Comment pep:putative chromosome:GRCh37:12:31825212:31881955:-1 gene:ENSG00000151743 transcript:ENST00000536761 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKNISRYLTDIKPLPPNIKDRLIKIMSMQGQITDSNISEILHPEVQTLDLRSCDISDAAL
LHLSNCRKLKKLNLNASKGNRVSVTSEGIKAVASSCSYLHEASLKRCCNLTDEGVVALAL
NCQLLKIIDLGGCLSITDVSLHALGKNCPFLQCVDFSATQVSDSGVIALVSGPCAKKLEE
IHMGHCVNLTDGAVEAVLTYCPQIRILLFHGCPLITDHSREVLEQLVGPNKLKQVTWTVY
Download sequence
Identical sequences ENSP00000440967 ENSP00000441419 NP_001265340.1.87134 NP_001265340.1.92137 NP_001265341.1.87134 NP_001265341.1.92137 XP_016874452.1.92137 XP_016874453.1.92137 XP_016874454.1.92137 ENSP00000440967 ENSP00000441419

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]