SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000440990 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000440990
Domain Number 1 Region: 33-188
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 1.12e-47
Family Actin/HSP70 0.000000147
Further Details:      
 
Weak hits

Sequence:  ENSP00000440990
Domain Number - Region: 1-26
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 0.00107
Family Actin/HSP70 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000440990   Gene: ENSG00000106526   Transcript: ENST00000539352
Sequence length 210
Comment pep:known chromosome:GRCh37:7:149944302:150020758:-1 gene:ENSG00000106526 transcript:ENST00000539352 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGIVIDSGDGVTHVIPVAEGYVIGSC
IKHIPIAGRDITYFIQQLLREREVGIPPEQSLETAKAIKEKYCYICPDIVKEFAKYDVDP
QKWIKQYTGINAINQKKFVIDVGYERFLGPEIFFHPEFANPDSMESISDVVDEVIQNCPI
DVRRPLYKMEQIPLSYPQGHGFHPLSPPFH
Download sequence
Identical sequences Q9C0K3
ENSP00000252071 gi|256574835|ref|NP_001157930.1| gi|256574837|ref|NP_001157931.1| ENSP00000252071 ENSP00000440990 9606.ENSP00000252071 NP_001157930.1.87134 NP_001157930.1.92137 NP_001157931.1.87134 NP_001157931.1.92137 XP_011514808.1.92137 XP_011514809.1.92137 XP_011514810.1.92137 XP_016868038.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]