SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000441009 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000441009
Domain Number 1 Region: 80-138
Classification Level Classification E-value
Superfamily RNI-like 0.00000000000113
Family 28-residue LRR 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000441009   Gene: ENSG00000187905   Transcript: ENST00000543388
Sequence length 161
Comment pep:known chromosome:GRCh37:22:21400270:21416565:1 gene:ENSG00000187905 transcript:ENST00000543388 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGSCERSGEDEEQKEEAMVACGRLSGVPEAEQGPEANWDSDLETEGTDGLGELVRDTLY
LRSCRAHSVVPISCFLRQGSAQELNLRHRGLGPQGARALASSLSSNPYVKRLDLRDNGLC
GAGAEALAGALSKSSSIHGRCWVWGRWAGVSSFSSGMCLHR
Download sequence
Identical sequences ENSP00000441009

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]