SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000441024 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000441024
Domain Number 1 Region: 440-496
Classification Level Classification E-value
Superfamily UBA-like 0.0000000000383
Family UBA domain 0.00014
Further Details:      
 
Domain Number 2 Region: 511-562
Classification Level Classification E-value
Superfamily UBA-like 0.0000379
Family UBA domain 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000441024   Gene: ENSG00000165006   Transcript: ENST00000545103
Sequence length 566
Comment pep:known chromosome:GRCh37:9:34179003:34252521:1 gene:ENSG00000165006 transcript:ENST00000545103 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGAVRGRRREVGLQHGGCGTGGGYGDGLARSGQSWRWWRSLSLGAVGSSAGTEPGRPAG
ASTFRLLRRRQQRHSGTFSYLDDVPFKTGDKFKTPAKVGLPIGFSLPDCLQVVREVQYDF
SLEKKTIEWAEEIKKIEEAEREAECKIAEAEAKVNSKSGPEGDSKMSFSKTHSTATMPPP
INPILASLQHNSILTPTRVSSSATKQKVLSPPHIKADFNLADFECEEDPFDNLELKTIDE
KEELRNILVGTTGPIMAQLLDNNLPRGGSGSVLQDEEVLASLERATLDFKPLHKPNGFIT
LPQLGNCEKMSLSSKVSLPPIPAVSNIKSLSFPKLDSDDSNQKTAKLASTFHSTSCLRNG
TFQNSLKPSTQSSASELNGHHTLGLSALNLDSGTEMPALTSSQMPSLSVLSVCTEESSPP
NTGPTVTPPNFSVSQVPNMPSCPQAYSELQMLSPSERQCVETVVNMGYSYECVLRAMKKK
GENIEQILDYLFAHGQLCEKGFDPLLVEEALEMHQCSEEKMMEFLQLMSKFKEMGFELKD
IKEVLLLHNNDQDNALEDLMARAGAS
Download sequence
Identical sequences ENSP00000368484 NP_001164672.1.87134 NP_001164672.1.92137 ENSP00000441024 gi|283945558|ref|NP_001164672.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]