SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000441562 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000441562
Domain Number 1 Region: 489-556
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000127
Family HLH, helix-loop-helix DNA-binding domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000441562   Gene: ENSG00000196628   Transcript: ENST00000544241
Sequence length 600
Comment pep:known chromosome:GRCh37:18:52895086:53071226:-1 gene:ENSG00000196628 transcript:ENST00000544241 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKDIFFQFIIARVRKCYSLSCLHTLPVVPTLRKTERGSYSSYGRESNLQGCHQSLLGGDM
DMGNPGTLSPTKPGSQYYQYSSNNPRRRPLHSSAMEVQTKKVRKVPPGLPSSVYAPSAST
ADYNRDSPGYPSSKPATSTFPSSFFMQDGHHSSDPWSSSSGMNQPGYAGMLGNSSHIPQS
SSYCSLHPHERLSYPSHSSADINSSLPPMSTFHRSGTNHYSTSSCTPPANGTDSIMANRG
SGAAGSSQTGDALGKALASIYSPDHTNNSFSSNPSTPVGSPPSLSAGTAVWSRNGGQASS
SPNYEGPLHSLQSRIEDRLERLDDAIHVLRNHAVGPSTAMPGGHGDMHGIIGPSHNGAMG
GLGSGYGTGLLSANRHSLMVGTHREDGVALRGSHSLLPNQVPVPQLPVQSATSPDLNPPQ
DPYRGMPPGLQGQSVSSGSSEIKSDDEGDENLQDTKSSEDKKLDDDKKDIKSITRSRSSN
NDDEDLTPEQKAEREKERRMANNARERLRVRDINEAFKELGRMVQLHLKSDKPQTKLLIL
HQAVAVILSLEQQVRERNLNPKAACLKRREEEKVSSEPPPLSLAGPHPGMGDASNHMGQM
Download sequence
Identical sequences A0A2I2Z493 A0A2I3FPY7 A0A2I3MYF4 A0A2I3S161 A0A2J8UES9 A0A2K5HCY1 A0A2K5NQD1 A0A2K5W404 A0A2K5XNF1 A0A2K6DUQ7 A0A2K6MS56 A0A2K6QNS0 F7CLG1
ENSP00000441562 ENSMMUP00000041207 NP_001230161.1.87134 NP_001230161.1.92137 XP_004087752.1.23891 XP_005586678.1.63531 XP_008950871.1.60992 XP_011731756.1.29376 XP_011804532.1.43180 XP_011827114.1.47321 XP_011924351.1.92194 XP_014977531.1.72884 XP_016789262.1.37143 XP_018869494.1.27298 ENSP00000441562

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]