SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000441846 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000441846
Domain Number 1 Region: 33-75
Classification Level Classification E-value
Superfamily RNI-like 0.000000216
Family Cyclin A/CDK2-associated p19, Skp2 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000441846   Gene: ENSG00000151743   Transcript: ENST00000537960
Sequence length 87
Comment pep:putative chromosome:GRCh37:12:31854797:31881953:-1 gene:ENSG00000151743 transcript:ENST00000537960 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKNISRYLTDIKPLPPNIKDRLIKIMSMQGQITDSNISEILHPEVQTLDLRSCDISDAAL
LHLSNCRKLKKLNLNASKGNRVSVTSE
Download sequence
Identical sequences F5GWF7
ENSP00000441846 ENSP00000441846

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]