SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000442272 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000442272
Domain Number - Region: 3-34
Classification Level Classification E-value
Superfamily RNI-like 0.00377
Family Rna1p (RanGAP1), N-terminal domain 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000442272   Gene: ENSG00000151743   Transcript: ENST00000542781
Sequence length 35
Comment pep:putative chromosome:GRCh37:12:31826486:31881955:-1 gene:ENSG00000151743 transcript:ENST00000542781 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGHCVNLTDGAVEAVLTYCPQIRILLFHGCPLITG
Download sequence
Identical sequences A0A2I3HUL3 A0A2I3LV63 A0A2I3T2D0 A0A2J8WC44 A0A2K5MZC2 A0A2K5RGW4 A0A2K5W8T5 A0A2K5ZWU7 A0A2K6CKI0 A0A2K6FSV7 A0A2K6TDS0 F5H7U5 G3QMC7
ENSP00000442272 ENSP00000442272

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]