SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000444026 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000444026
Domain Number 1 Region: 31-237
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 1.85e-25
Family COMT-like 0.091
Further Details:      
 
Weak hits

Sequence:  ENSP00000444026
Domain Number - Region: 261-278
Classification Level Classification E-value
Superfamily SOCS box-like 0.0432
Family SOCS box-like 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000444026   Gene: ENSG00000168300   Transcript: ENST00000544451
Sequence length 281
Comment pep:known chromosome:GRCh37:8:52730140:52811735:-1 gene:ENSG00000168300 transcript:ENST00000544451 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGPRRLRSPGGSGCSSRGSGPRLSTRRWRPCCYCGGSGVWLLRTPPSPSAWPARRCPRH
RFEFCEPAFVVGNCLQIASDSHQYDRIYCGAGVQKDHENYMKILLKVGGILVMPIEDQLT
QIMRTGQNTWESKNILAVSFAPLVQPSKNDNGKPDSVGLPPCAVRNLQDLARIYIRRTLR
NFINDEMQAKGIPQRAPPKRKRKRVKQRINTYVFVGNQLIPQPLDSEEDEKMEEDNKEEE
EKDHNEAMKPEEPPQNLLREKIMKLPLPESLKAYLTYFRDK
Download sequence
Identical sequences A0A2I2YGW6 F5H1M8
ENSP00000444026 ENSP00000444026 NP_001273711.1.87134 NP_001273711.1.92137 XP_018888226.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]