SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000444093 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000444093
Domain Number 1 Region: 27-126
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.71e-26
Family Ankyrin repeat 0.00062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000444093   Gene: ENSG00000177981   Transcript: ENST00000539503
Sequence length 127
Comment pep:known chromosome:GRCh37:12:48543634:48574996:-1 gene:ENSG00000177981 transcript:ENST00000539503 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSSMWYIMQSIQSKYSLSERLIRTIAAIRSFPHDNVEDLIRGGADVNCTHGTLKPLHCA
CMVSDADCVELLLEKGAEVNALDGYNRTALHYAAEKDEACVEVLLEYGANPNALDGNRDT
PLHWAAF
Download sequence
Identical sequences A0A2J8LQB2 A0A2J8WD38 F5GZZ3
ENSP00000444093 ENSP00000444093

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]