SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000444431 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000444431
Domain Number 1 Region: 2-152
Classification Level Classification E-value
Superfamily WD40 repeat-like 4.58e-31
Family WD40-repeat 0.0017
Further Details:      
 
Domain Number 2 Region: 147-193
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000000314
Family SOCS box-like 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000444431   Gene: ENSG00000176871   Transcript: ENST00000544233
Sequence length 194
Comment pep:known chromosome:GRCh37:12:118471970:118498919:-1 gene:ENSG00000176871 transcript:ENST00000544233 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLCSAAGEKSVFLWSMRSYTLIRKLEGHQSSVVSCDFSPDSALLVTASYDTNVIMWDPYT
GERLRSLHHTQVDPAMDDSDVHISSLRSVCFSPEGLYLATVADDRLLRIWALELKTPIAF
APMTNGLCCTFFPHGGVIATGTRDGHVQFWTAPRVLSSLKHLCRKALRSFLTTYQVLALP
IPKKMKEFLTYRTF
Download sequence
Identical sequences A0A1D5QKP1 A0A2J8ME16 A0A2J8XKC8 A0A2K5QGP9 A0A2K6BWW8 I7GH93
ENSP00000444431 NP_001265487.1.87134 NP_001265487.1.92137 XP_008956053.1.60992 XP_011819791.1.47321 XP_014202798.1.60992 XP_016875131.1.92137 XP_018893825.1.27298 ENSP00000444431

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]