SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000444507 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000444507
Domain Number 1 Region: 55-128
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000000327
Family HLH, helix-loop-helix DNA-binding domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000444507   Gene: ENSG00000175727   Transcript: ENST00000542417
Sequence length 171
Comment pep:putative chromosome:GRCh37:12:122620175:122625495:1 gene:ENSG00000175727 transcript:ENST00000542417 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XHGGSPQVTVTGPSRDCPNSGQASPCASEQSPSPQSPQNNCSGKSDPKNVAALKNRQMKH
ISAEQKRRFNIKMCFDMLNSLISNNSKLTSHAITLQKTVEYITKLQQERGQMQEEARRLR
EEIEELNATIIDPFSVGRYFPAPGERSTPVQPPSGLQSPAPLRACLFFNHT
Download sequence
Identical sequences A0A0G2JQX8 H0YGR9
ENSP00000444507 ENSP00000444507

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]