SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000444535 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000444535
Domain Number - Region: 101-117
Classification Level Classification E-value
Superfamily UBA-like 0.037
Family UBA domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000444535   Gene: ENSG00000131023   Transcript: ENST00000542720
Sequence length 135
Comment pep:known chromosome:GRCh37:6:150005540:150039160:-1 gene:ENSG00000131023 transcript:ENST00000542720 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MKRSEKPEGYRQMRPKTFPASNYTVSSRQMLQEIRESLRNLSKPSDAAKAEHNMSKMSTE
DPRQVRNPPKFGTHHKALQEIRNSLLPFANETNSSRSTSEVNPQMLQDLQAAGFDEEDHL
SVACSPISLTKPFLI
Download sequence
Identical sequences Q6PJG3
ENSP00000403815 ENSP00000444535 ENSP00000403815 ENSP00000444535

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]