SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000444773 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000444773
Domain Number 1 Region: 262-567,595-652
Classification Level Classification E-value
Superfamily RNI-like 1.86e-29
Family 28-residue LRR 0.023
Further Details:      
 
Domain Number 2 Region: 2-86,135-219
Classification Level Classification E-value
Superfamily RNI-like 4.32e-29
Family 28-residue LRR 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000444773   Gene: ENSG00000140853   Transcript: ENST00000538453
Sequence length 702
Comment pep:known chromosome:GRCh37:16:57068084:57117443:1 gene:ENSG00000140853 transcript:ENST00000538453 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
QKCQLQVHDAEALIALLQEGPHLEEVDLSGNQLEDEGCRLMAEAASQLHIARKLDLSNNG
LSVAGVHCVLRAVSACWTLAELHISLQHKTVIFMFAQEPEEQKGPQERAAFLDSLMLQMP
SELPLSSRRMRLTHCGLQEKHLEQLCKALGGSCHLGHLHLDFSGNALGDEGAARLAQLLP
GLGALQSLNLSENGLSLDAVLGLVRCFSTLQWLFRLDISFESQHILLRGDKTSRDMWATG
SLPDFPAAAKFLGFRQRCIPRSLCLSECPLEPPSLTRLCATLKDCPGPLELQLSCEFLSD
QSLETLLDCLPQLPQLSLLQLSQTGLSPKSPFLLANTLSLCPRVKKVDLRSLHHATLHFR
SNEEEEGVCCGRFTGCSLSQEHVESLCWLLSKCKDLSQVDLSANLLGDSGLRCLLECLPQ
VPISGLLDLSHNSISQESALYLLETLPSCPRVREASVNLGSEQSFRIHFSREDQAGKTLR
LSECSFRPEHVSRLATGLSKSLQLTELTLTQCCLGQKQLAILLSLVGRPAGLFSLRVQEP
WADRARVLSLLEVCAQASGSVTEISISETQQQLCVQLEFPRQEENPEAVALRLAHCDLGA
HHSLLVGQLMETCARLQQLSLSQVNLCEDDDASSLLLQSLLLSLSELKTFRIQSSQDPGR
LLPDLLPFDPHQADLQLCEHRGPRPPGIWSGPLPPLGGAGLV
Download sequence
Identical sequences H0YGT6
ENSP00000444773 ENSP00000444773

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]