SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000444960 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000444960
Domain Number 1 Region: 3-91
Classification Level Classification E-value
Superfamily RNI-like 0.000000000000196
Family 28-residue LRR 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000444960   Gene: ENSG00000140853   Transcript: ENST00000545349
Sequence length 110
Comment pep:known chromosome:GRCh37:16:57103789:57111281:1 gene:ENSG00000140853 transcript:ENST00000545349 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
XASGLGHCHHLEELDLSNNQFDEEGTKALMRALEGKWMLKRLDLSHLLLNSSTLALLTHR
LSQMTCLQSLSLTLSPRLECSGMISLHCNLCLLGSSDSGASAAQVAGITD
Download sequence
Identical sequences H0YGV6
ENSP00000444960 ENSP00000444960

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]