SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000445039 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000445039
Domain Number 1 Region: 2-100
Classification Level Classification E-value
Superfamily RNI-like 1.92e-18
Family 28-residue LRR 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000445039   Gene: ENSG00000153558   Transcript: ENST00000542085
Sequence length 133
Comment pep:known chromosome:GRCh37:3:33331168:33427173:1 gene:ENSG00000153558 transcript:ENST00000542085 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLEECILITDSTLIQLSIHCPKLQALSLSHCELITDDGILHLSNSTCGHERLRVLELDN
CLLITDVALEHLENCRGLERLELYDCQQVTRAGIKRMRAQLPHVKVHAYFAPVTPPTAVA
GSGQRLCRCCVIL
Download sequence
Identical sequences B4DY12
ENSP00000445039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]