SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000445097 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000445097
Domain Number 1 Region: 102-117,194-423
Classification Level Classification E-value
Superfamily RNI-like 3.14e-22
Family 28-residue LRR 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000445097   Gene: ENSG00000185686   Transcript: ENST00000539862
Sequence length 493
Comment pep:known chromosome:GRCh37:22:22890128:22896603:-1 gene:ENSG00000185686 transcript:ENST00000539862 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVWTSPRRLVELAGQSLLKDEALAIAALELLPRELFPPLFMAAFDGRHSQTLKAMVQAW
PFTCLPLGVLMKGQHLHLETFKAVLDGLDVLLAQEVRPRRWKLQVLDLRKNSHQDFWTVW
SGNRASLYSFPEPEAAQPMTKKRKVDGLSTEAEQPFIPVEVLVDLFLKEGACDELFSYLI
EKVKRKKNVLRLCCKKLKIFAMPMQDIKMILKMVQLDSIEDLEVTCTWKLPTLAKFSPYL
GQMINLRRLLLSHIHASSYISPEKEEQYIAQFTSQFLSLQCLQALYVDSLFFLRGRLDQL
LRHVMNPLETLSITNCRLSEGDVMHLSQSPSVSQLSVLSLSGVMLTDVSPEPLQALLERA
SATLQDLVFDECGITDDQLLALLPSLSHCSQLTTLSFYGNSISISALQSLLQHLIGLSNL
THVLYPVPLESYEDIHGTLHLERLAYLHARLRELLCELGRPSMVWLSANPCPHCGDRTFY
DPEPILCPCFMPN
Download sequence
Identical sequences NP_001278646.1.87134 NP_001278646.1.92137 NP_001278648.1.87134 NP_001278648.1.92137 NP_001305055.1.87134 NP_001305055.1.92137 NP_001305056.1.87134 NP_001305056.1.92137 XP_011528336.1.92137 ENSP00000407342 ENSP00000445097

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]