SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000445252 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000445252
Domain Number 1 Region: 69-185
Classification Level Classification E-value
Superfamily RNI-like 0.00000000000000589
Family 28-residue LRR 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000445252   Gene: ENSG00000104866   Transcript: ENST00000544069
Sequence length 186
Comment pep:novel chromosome:GRCh37:19:45596432:45645455:1 gene:ENSG00000104866 transcript:ENST00000544069 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEIAPQEAPPVPGADGDIEEAPAEAGSPSPASPPADGRLKAAAKRVTFPSDEDIVSGAVE
PKDPWRHGEKLDYKTCEALEEVFKRLQFKVVDLEQTNLDEDGASALFDMIEYYESATHLN
ISFNKHIGTRGWQAAAHMMRKTSCLQYLDARNTPLLDHSAPFVARALRIRSSLAVLHLEN
ASLSGR
Download sequence
Identical sequences F5H3P7
ENSP00000445252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]