SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000445578 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000445578
Domain Number 1 Region: 19-391
Classification Level Classification E-value
Superfamily PLP-dependent transferases 4.46e-114
Family AAT-like 0.00000000000274
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000445578   Gene: ENSG00000120053   Transcript: ENST00000543866
Sequence length 392
Comment pep:known chromosome:GRCh37:10:101157220:101190202:-1 gene:ENSG00000120053 transcript:ENST00000543866 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQVWSPWKGAMCPRPHKPAYRTDDCHPWVLPVVKKVEQKIANDNSLNHEYLPILGLAEFR
SCASRLALGDDSPALKEKRVGGVQSLGGTGALRIGADFLARWYNGTNNKNTPVYVSSPTW
ENHNAVFSAAGFKDIRSYRYWDAEKRGLDLQGFLNDLENAPEFSIVVLHACAHNPTGIDP
TPEQWKQIASVMKHRFLFPFFDSAYQGFASGNLERDAWAIRYFVSEGFEFFCAQSFSKNF
GLYNERVGNLTVVGKEPESILQVLSQMEKIVRITWSNPPAQGARIVASTLSNPELFEEWT
GNVKTMADRILTMRSELRARLEALKTPGTWNHITDQIGMFSFTGLNPKQVEYLVNEKHIY
LLPSGRINVSGLTTKNLDYVATSIHEAVTKIQ
Download sequence
Identical sequences ENSP00000445578

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]