SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000445743 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000445743
Domain Number 1 Region: 158-440
Classification Level Classification E-value
Superfamily Cysteine proteinases 6.67e-49
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.0021
Further Details:      
 
Domain Number 2 Region: 2-76
Classification Level Classification E-value
Superfamily UBA-like 3.02e-27
Family UBA domain 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000445743   Gene: ENSG00000048028   Transcript: ENST00000537706
Sequence length 583
Comment pep:putative chromosome:GRCh37:11:113684477:113746250:-1 gene:ENSG00000048028 transcript:ENST00000537706 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTAELQQDDAAGAADGHGSSCQMLLNQLREITGIQDPSFLHEALKASNGDITQAVSLLTD
ERVKEPSQDTVATEPSEVEGSAANKEVLAKVIDLTHDNKDDLQAAIALSLLESPKIQADG
RDLNRMHEATSAETKRSKRKRCEVWGENPNPNDWRRVDGWPVGLKNVGNTCWFSAVIQSL
FQLPEFRRLVLSYSLPQNVLENCRSHTEKRNIMFMQELQYLFALMMGSNRKFVDPSAALD
LLKGAFRSSEEQQQDVSEFTHKLLDWLEDAFQLAVNVNSPRNKSENPMVQLFYGTFLTEG
VREGKPFCNNETFGQYPLQVNGYRNLDECLEGAMVEGDVELLPSDHSVKYGQERWFTKLP
PVLTFELSRFEFNQSLGQPEKIHNKLEFPQIIYMDRYMYRSKELIRNKRECIRKLKEEIK
ILQQKLERYVKYGSGPARFPLPDMLKYVIEFASTKPASESCPPESDTHMTLPLSSVHCSV
SDQTSKESTSTESSSQDVESTFSSPEDSLPKSKPLTSSRSSMEMPSQPAPRTVTDEEINF
VKTCLQRWRSEIEQDIQDLKTCIASTTQTIEQMYCDPLLRQVE
Download sequence
Identical sequences ENSP00000445743 ENSP00000445743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]