SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000445891 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000445891
Domain Number 1 Region: 190-270
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000000445
Family HLH, helix-loop-helix DNA-binding domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000445891   Gene: ENSG00000175727   Transcript: ENST00000366272
Sequence length 308
Comment pep:putative chromosome:GRCh37:12:122618868:122623488:1 gene:ENSG00000175727 transcript:ENST00000366272 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLGALVALSSCPLGLRTSCLTGREAASAGWARPCGPGLHLNILLILAAAFSGQPQAVIM
TSGPLKREGMLASTVSQSNVVIAPAAIARAPGVPEFHSSILVTDLGHGTSSPPAPVSRLF
PSTAQDPLGKGEQVPLHGGSPQVTVTGPSRDCPNSGQASPCASEQSPSPQSPQNNCSGKS
DPKNVAALKNRQMKHISAEQKRRFNIKMCFDMLNSLISNNSKLTSHAITLQKTVEYITKL
QQERGQMQEEARRLREEIEELNATIISCQQLLPATGVPVTRRQFDHMKDMFDEYVKTRTL
QNWKFWIV
Download sequence
Identical sequences A0A0G2JR68 A0A2J8MDA1 F5H0V4
ENSP00000445891 ENSP00000445891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]