SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000446113 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000446113
Domain Number 1 Region: 40-234
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.43e-37
Family FAD/NAD-linked reductases, N-terminal and central domains 0.000000277
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000446113   Gene: ENSG00000156709   Transcript: ENST00000535724
Sequence length 237
Comment pep:known chromosome:GRCh37:X:129263337:129299638:-1 gene:ENSG00000156709 transcript:ENST00000535724 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKEDEKRYNERISGLGLTPEQKQKKAALSASEGEEVPQDKAPSHVPFLLIGGGTAAFAAA
RSIRARDPGARVLIVSEDPELPYMRPPLSKELWFSDDPNVTKTLRFKQWNGKERSIYFQP
PSFYVSAQDLPHIENGGVAVLTGKKVVQLDVRDNMVKLNDGSQITYEKCLIATGGTPRSL
SAIDRAGAEVKSRTTLFRKIGDFRSLEKISREVKSITIIGGGFLGSELACALGRKDI
Download sequence
Identical sequences ENSP00000446113

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]