SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000447296 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000447296
Domain Number - Region: 27-66
Classification Level Classification E-value
Superfamily UBA-like 0.0187
Family UBA domain 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000447296   Gene: ENSG00000123352   Transcript: ENST00000549538
Sequence length 66
Comment pep:known chromosome:GRCh37:12:49760639:49883342:1 gene:ENSG00000123352 transcript:ENST00000549538 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRKQNQKDSSGFIFDLQSNTVLAQGGAFENMKEKINAVRAIVPNKSNNEIILVLQHFDN
CVDKTV
Download sequence
Identical sequences A0A2J8SYK7 F8VZS5
ENSP00000447296 ENSP00000447296

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]