SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000447324 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000447324
Domain Number 1 Region: 3-144
Classification Level Classification E-value
Superfamily TPR-like 4.93e-21
Family HAT/Suf repeat 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000447324   Gene: ENSG00000075856   Transcript: ENST00000550322
Sequence length 156
Comment pep:putative chromosome:GRCh37:12:108936845:108943104:-1 gene:ENSG00000075856 transcript:ENST00000550322 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARQKMSEIFPLTEELWLEWLHDEISMAQDGLDREHVYDLFEKAVKDYICPNIWLEYGQY
SVGGIGQKGGLEKVRSVFERALSSVGLHMTKGLALWEAYREFESAIVEAARLEKVHSLFR
RQLAIPLYDMEATFAEYEEWSEDPIPESVIQNYNKA
Download sequence
Identical sequences F8VZM2
ENSP00000447324 ENSP00000447324

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]