SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000447432 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000447432
Domain Number 1 Region: 213-286
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.66e-25
Family SPRY domain 0.00072
Further Details:      
 
Domain Number 2 Region: 16-76
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 1.53e-17
Family B-box zinc-binding domain 0.00013
Further Details:      
 
Weak hits

Sequence:  ENSP00000447432
Domain Number - Region: 59-148
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.0288
Family Apolipoprotein A-I 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000447432   Gene: ENSG00000206495   Transcript: ENST00000550618
Sequence length 417
Comment pep:known chromosome:GRCh37:HSCHR6_MHC_QBL:30284118:30304091:1 gene:ENSG00000206495 transcript:ENST00000550618 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVEIAKQLQAVKRKIRDESLCPQHHEALSLFCYEDQEAVCLICAISHTHRAHTVVPLDDA
TQEYKEKLQKCLEPLEQKLQEITRCKSSEEKKPGELKRLVESRRQQILREFEELHRRLDE
EQQVLLSRLEEEEQDILQRLRENAAHLGDKRRDLAHLAAEVEGKCLQSGFEMLKPVLSAR
EECEKVKTMEVTSVSIELEKNFSNFPRQYFALRKILKQLIADVTLDPETAHPNLVLSEDR
KSVKFVETRLRDLPDTPRRFTFYPCVLATEGFTSGRHYWEVEAAHCVLAQDPENQALARF
YCYTERTIAKRLVLRRDPSVKRTLCRGCSSLLVPGLTCTHRQRRCRGQRWTVQTCLTCQR
SQRFLNDPGHLLWGDRPEAQLGSQADSKPLQPLPNTAHSISDRLPEEKMQTQGSSNQ
Download sequence
Identical sequences ENSP00000447432 ENSP00000448191 ENSP00000449807

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]