SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000447839 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000447839
Domain Number 1 Region: 251-416
Classification Level Classification E-value
Superfamily PH domain-like 9.98e-49
Family Phosphotyrosine-binding domain (PTB) 0.0019
Further Details:      
 
Domain Number 2 Region: 32-103
Classification Level Classification E-value
Superfamily SAM/Pointed domain 6.87e-19
Family SAM (sterile alpha motif) domain 0.0069
Further Details:      
 
Domain Number 3 Region: 106-169
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.77e-16
Family SAM (sterile alpha motif) domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000447839   Gene: ENSG00000185046   Transcript: ENST00000546960
Sequence length 460
Comment pep:known chromosome:GRCh37:12:99139611:99548270:-1 gene:ENSG00000185046 transcript:ENST00000546960 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMWQCHLSAQDYRYYPVDGYSLLKRFPLHPLTGPRCPVQTVGQWLESIGLPQYENHLMAN
GFDNVQFMGSNVMEDQDLLEIGILNSGHRQRILQAIQLLPKMRPIGHDGYHPTSVAEWLD
SIELGDYTKAFLINGYTSMDLLKKIWEVELINVLKINLIGHRKRILASLGDRLHDDPPQK
PPRSITLREPSGNHTPPQLSPSLSQSTYTTGGSLDVPHIIMQGDARRRRNENYFDDIPRS
KLERQMAQTGDWGEPSITLRPPNEATASTPVQYWQHHPEKLIFQSCDYKAFYLGSMLIKE
LRGTESTQDACAKMRANCQKSTEQMKKVPTIILSVSYKGVKFIDATNKNIIAEHEIRNIS
CAAQDPEDLSTFAYITKDLKSNHHYCHVFTAFDVNLAYEIILTLGQAFEVAYQLALQARK
GGHSSTLPESFENKPSKPIPKPRVSIRKSVPFCFKADRPI
Download sequence
Identical sequences A0A2J8N0F7 A0A2J8XMN3 G1R2K3
ENSP00000447839 NP_001190997.1.87134 NP_001190997.1.92137 XP_003259759.1.23891 XP_003313925.1.37143 XP_003405331.1.64505 XP_004269543.1.21590 XP_004381318.1.4749 XP_004418057.1.5094 XP_005572018.1.63531 XP_006876003.1.41390 XP_007165898.1.59432 XP_007467232.1.90284 XP_007945381.1.48129 XP_008002547.1.81039 XP_009002682.1.60252 XP_010338499.1.74449 XP_010354243.1.97406 XP_011789883.1.43180 XP_011847621.1.47321 XP_015007999.1.72884 XP_017366597.1.71028 XP_019773991.1.83887 XP_020948671.1.46622 ENSP00000447839 gi|323276634|ref|NP_001190997.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]