SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000448522 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000448522
Domain Number 1 Region: 27-72
Classification Level Classification E-value
Superfamily UBA-like 0.0000952
Family UBA domain 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000448522   Gene: ENSG00000123352   Transcript: ENST00000551540
Sequence length 74
Comment pep:known chromosome:GRCh37:12:49761279:49884474:1 gene:ENSG00000123352 transcript:ENST00000551540 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRKQNQKDSSGFIFDLQSNTVLAQGGAFENMKEKINAVRAIVPNKSNNEIILVLQHFDN
CVDKTVQAFMEGSA
Download sequence
Identical sequences A0A2J8LPV7 A0A2J8SYK0 F8VRH4
ENSP00000448522 ENSP00000448522

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]