SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000449567 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000449567
Domain Number - Region: 8-103
Classification Level Classification E-value
Superfamily ARM repeat 0.0307
Family HEAT repeat 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000449567   Gene: ENSG00000136021   Transcript: ENST00000550251
Sequence length 115
Comment pep:known chromosome:GRCh37:12:100709335:100720423:1 gene:ENSG00000136021 transcript:ENST00000550251 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
XRVIVQRILPCLTSEFVNPDMVPFVLPNVLLIAEECTKEEYVKLILPELGPVFKQQEPIQ
ILLIFLQKMDLLLTKTPPDEIKNSVLPMVYRALEAPSIQIQICLLKGEGMLPLSK
Download sequence
Identical sequences ENSP00000449567 ENSP00000449567

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]