SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000449848 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000449848
Domain Number 1 Region: 1-54
Classification Level Classification E-value
Superfamily DEATH domain 0.00000000000000439
Family DEATH domain, DD 0.0000646
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000449848   Gene: ENSG00000198001   Transcript: ENST00000550386
Sequence length 54
Comment pep:known chromosome:GRCh37:12:44152764:44180706:1 gene:ENSG00000198001 transcript:ENST00000550386 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MNKPITPSTYVRCLNVGLIRKLSDFIDPQEGWKKLAVAIKKPSGDDRYNQFHIR
Download sequence
Identical sequences A0A2I2Z1D3 A0A2J8LQV0 F8VW24
ENSP00000449317 ENSP00000449848 ENSP00000449317 ENSP00000449848

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]