SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000450079 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000450079
Domain Number - Region: 105-181
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 0.053
Family Picornaviridae-like VP (VP1, VP2, VP3 and VP4) 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000450079   Gene: ENSG00000184774   Transcript: ENST00000549576
Sequence length 205
Comment pep:known chromosome:GRCh37:1:202792385:202796353:1 gene:ENSG00000184774 transcript:ENST00000549576 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSFATKFSDYFLLIEDNVFFAPNFVTHIHSRVTTMKSNSWVLMEFSNMGFLGKLFHSRDL
PLLAHFLLLFYKEKPLDSLISHFHTLLVQESPILCRPFLFYCRVSYTAFDHKQKATALQK
KNADGPNNPPGAVFTDMQVSDVHFPWEAYTLDESFFWTHNISIGNHLTVILNHPANLSRV
QVMTGSIVEWEVRPGEGAGGAGLPT
Download sequence
Identical sequences ENSP00000446921 ENSP00000450079 ENSP00000446921 ENSP00000450079 ENSP00000446921

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]