SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000451092 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000451092
Domain Number 1 Region: 34-106
Classification Level Classification E-value
Superfamily L domain-like 0.000000034
Family Ngr ectodomain-like 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000451092   Gene: ENSG00000165409   Transcript: ENST00000555326
Sequence length 112
Comment pep:known chromosome:GRCh37:14:81421973:81557476:1 gene:ENSG00000165409 transcript:ENST00000555326 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MRPADLLQLVLLLDLPRDLGGMGCSSPPCECHQEEDFRVTCKDIQRIPSLPPSTQTLKLI
ETHLRTIPSHAFSNLPNISRIYVSIDVTLQQLESHSFYNLSKVTHITDTDAL
Download sequence
Identical sequences G3V381
ENSP00000451092 ENSP00000451092

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]