SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000451170 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000451170
Domain Number 1 Region: 62-174
Classification Level Classification E-value
Superfamily DNase I-like 1.18e-27
Family DNase I-like 0.000000412
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000451170   Gene: ENSG00000100823   Transcript: ENST00000556054
Sequence length 174
Comment pep:known chromosome:GRCh37:14:20923406:20925233:1 gene:ENSG00000100823 transcript:ENST00000556054 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPKRGKKGAVAEDGDELRTEPEAKKSKTAAKKNDKEAAGEGPALYEDPPDQKTSPSGKPA
TLKICSWNVDGLRAWIKKKGLDWVKEEAPDILCLQETKCSENKLPAELQELPGLSHQYWS
APSDKEGYSGVGLLSRQCPLKVSYGIGDEEHDQEGRVIVAEFDSFVLVTAYVPN
Download sequence
Identical sequences G3V3C7
ENSP00000451170 ENSP00000451170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]