SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000451654 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000451654
Domain Number 1 Region: 26-111
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000000000156
Family Ankyrin repeat 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000451654   Gene: ENSG00000100628   Transcript: ENST00000555287
Sequence length 111
Comment pep:putative chromosome:GRCh37:14:94419751:94443065:-1 gene:ENSG00000100628 transcript:ENST00000555287 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLFQGVMQKYSSSLFKTSQLAPADPLIKAIKDGDEEALKTMIKEGKNLAEPNKEGWLPL
HEAAYYGQVGCLKVLQRAYPGTIDQRTLQEETAVYLATCRGHLDCLLSLLQ
Download sequence
Identical sequences G3V484
ENSP00000451654

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]