SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000451675 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000451675
Domain Number 1 Region: 1-35
Classification Level Classification E-value
Superfamily UBA-like 0.00000000357
Family TAP-C domain-like 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000451675   Gene: ENSG00000088833   Transcript: ENST00000555568
Sequence length 35
Comment pep:known chromosome:GRCh37:20:1426311:1447480:-1 gene:ENSG00000088833 transcript:ENST00000555568 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MAAERQEALREFVAVTGAEEDRARFFLESAGWDLQ
Download sequence
Identical sequences A0A2J8MS08 A0A2J8VI74 G3V4V8
ENSP00000451675 ENSP00000452019 ENSP00000451675 ENSP00000452019

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]