SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000451968 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000451968
Domain Number 1 Region: 20-149
Classification Level Classification E-value
Superfamily PLP-dependent transferases 4.26e-54
Family GABA-aminotransferase-like 0.000000339
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000451968   Gene: ENSG00000182199   Transcript: ENST00000555773
Sequence length 149
Comment pep:putative chromosome:GRCh37:12:57624137:57625696:1 gene:ENSG00000182199 transcript:ENST00000555773 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAIRAQHSNAAQTQTGEANRGWTGQESLSDSDPEMWELLQREKDRQCRGLELIASENFCS
RAALEALGSCLNNKYSEGYPGKRYYGGAEVVDEIELLCQRRALEAFDLDPAQWGVNVQPY
SGSPANLAVYTALLQPHDRIMGLDLPDGG
Download sequence
Identical sequences A0A2J8UHA0 G3V4T0
ENSP00000451968 ENSP00000451968

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]