SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000452378 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000452378
Domain Number 1 Region: 23-98
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 3.05e-21
Family HLH, helix-loop-helix DNA-binding domain 0.00000739
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000452378   Gene: ENSG00000125952   Transcript: ENST00000556979
Sequence length 103
Comment pep:known chromosome:GRCh37:14:65544005:65569235:-1 gene:ENSG00000125952 transcript:ENST00000556979 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDNDDIEVESDEEQPRFQSAADKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKASR
AQILDKATEYIQYMRRKNHTHQQDIDDLKRQNALLEQQGESES
Download sequence
Identical sequences A0A024R682 A0A0D9RLU7 A0A0P6JCC8 A0A250XUT7 A0A287BS72 A0A2I3H850 A0A2J8WLY0 A0A2K5DFI2 A0A2K6QVW9 A0A2K6UIC9 F6PP37 K7C589
gi|21704265|ref|NP_660088.1| ENSP00000378104 ENSP00000451907 ENSP00000452378 ENSP00000480127 ENSP00000378104 ENSP00000451907 ENSP00000452378 ENSCJAP00000036619 NP_660088.1.87134 NP_660088.1.92137 XP_004087204.1.23891 XP_006515587.1.92730 XP_008976013.1.60992 XP_016781732.1.37143 XP_020026514.1.5219

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]