SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000452686 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000452686
Domain Number - Region: 17-48
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0418
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000452686   Gene: ENSG00000137843   Transcript: ENST00000559139
Sequence length 109
Comment pep:known chromosome:GRCh37:15:40545089:40558165:1 gene:ENSG00000137843 transcript:ENST00000559139 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFRKKKKKRPEISAPQNFQHRVHTSFDPKEGKFVGLPPQWQNILDTLRRPKPVVDPSRIT
RVQLQPMKTVVRGSAMPVDGYISGLLNDIQKLSVISSNTLRGRSPTSRR
Download sequence
Identical sequences H0YK74
ENSP00000452686 ENSP00000452686

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]