SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000452786 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000452786
Domain Number 1 Region: 133-380
Classification Level Classification E-value
Superfamily vWA-like 1.07e-85
Family Integrin A (or I) domain 0.00000000029
Further Details:      
 
Domain Number 2 Region: 376-466
Classification Level Classification E-value
Superfamily Integrin domains 1.62e-33
Family Integrin domains 0.0000031
Further Details:      
 
Domain Number 3 Region: 632-716
Classification Level Classification E-value
Superfamily Integrin beta tail domain 9.15e-24
Family Integrin beta tail domain 0.0000037
Further Details:      
 
Domain Number 4 Region: 29-83
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000000942
Family Plexin repeat 0.0000277
Further Details:      
 
Domain Number 5 Region: 590-631
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000117
Family Integrin beta EGF-like domains 0.00033
Further Details:      
 
Domain Number 6 Region: 548-586
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000279
Family Integrin beta EGF-like domains 0.0015
Further Details:      
 
Weak hits

Sequence:  ENSP00000452786
Domain Number - Region: 516-548
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0262
Family Integrin beta EGF-like domains 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000452786   Gene: ENSG00000259207   Transcript: ENST00000559488
Sequence length 788
Comment pep:known chromosome:GRCh37:17:45331212:45389182:1 gene:ENSG00000259207 transcript:ENST00000559488 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRARPRPRPLWATVLALGALAGVGVGGPNICTTRGVSSCQQCLAVSPMCAWCSDEALPLG
SPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKGSGDSSQVTQVSPQRIALRLRP
DDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFG
AFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSR
NRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCH
VGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLS
MDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDT
VSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGT
FECGVCRCGPGWLGSQCECSEEDYRPSQQDECSPREGQPVCSQRGECLCGQCVCHSSDFG
KITGKYCECDDFSCVRYKGEMCSGHGQCSCGDCLCDSDWTGYYCNCTTRTDTCMSSNGLL
CSGRGKCECGSCVCIQPGSYGDTCEKCPTCPDACTFKKECVECKKFDRGALHDENTCNRY
CRDEIESVKELKDTGKDAVNCTYKNEDDCVVRFQYYEDSSGKSILYVVEEPECPKGPDIL
VVLLSVMGAILLIGLAALLIWKLLITIHDRKEFAKFEEERARAKWDTANNPLYKEATSTF
TNITYRGT
Download sequence
Identical sequences P05106
gi|47078292|ref|NP_000203.2| ENSP00000452786 9606.ENSP00000262017 NP_000203.2.87134 NP_000203.2.92137 ENSP00000262017 ENSP00000452786

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]