SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000452972 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000452972
Domain Number 1 Region: 626-695
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000009
Family IBR domain 0.0000132
Further Details:      
 
Domain Number 2 Region: 543-608
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000459
Family RING finger domain, C3HC4 0.013
Further Details:      
 
Domain Number 3 Region: 706-778
Classification Level Classification E-value
Superfamily RING/U-box 0.0000109
Family RING finger domain, C3HC4 0.038
Further Details:      
 
Domain Number 4 Region: 2-67
Classification Level Classification E-value
Superfamily PUG domain-like 0.0000248
Family PUG domain 0.016
Further Details:      
 
Domain Number 5 Region: 253-278
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.000034
Family Ran binding protein zinc finger-like 0.0029
Further Details:      
 
Domain Number 6 Region: 419-458
Classification Level Classification E-value
Superfamily UBA-like 0.0000919
Family UBA domain 0.01
Further Details:      
 
Weak hits

Sequence:  ENSP00000452972
Domain Number - Region: 202-228
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.000863
Family Ran binding protein zinc finger-like 0.0029
Further Details:      
 
Domain Number - Region: 310-335
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.00251
Family Ran binding protein zinc finger-like 0.0041
Further Details:      
 
Domain Number - Region: 116-147
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00816
Family TFIIH p44 subunit cysteine-rich domain 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000452972   Gene: ENSG00000092098   Transcript: ENST00000560787
Sequence length 917
Comment pep:novel chromosome:GRCh37:14:24617291:24629863:1 gene:ENSG00000092098 transcript:ENST00000560787 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XNNPVFRSTVDAVQGGRDVLRLYGYTEEQPDGLSFPEGQEEPDEHQVATVTLEVLLLRTE
LSLLLQNTHPRQQALEQLLEDKVEDDMLQLSEFDPLLREIAPGPLTTPSVPGSTPGPCFL
CGSAPGTLHCPSCKQALCPACDHLFHGHPSRAHHLRQTLPGVLQGTHLSPSLPASAQPRP
QSTSLLALGDSSLSSPNPASAHLPWHCAACAMLNEPWAVLCVACDRPRGCKGLGLGTEGP
QGTGGLEPDLARGRWACQSCTFENEAAAVLCSICERPRLAQPPSLVVDSRDAGICLQPLQ
QGDALLASAQSQVWYCIHCTFCNSSPGWVCVMCNRTSSPIPAQHAPRPYASSLEKGPPKP
GPPRRLSAPLPSSCGDPEKQRQDKMREEGLQLVSMIREARRAWLDRHGNLDEAVEECVRT
RRRKVQELQSLGFGPEEGSLQALFQHGGDVSRALTELQRQRLEPFRQRLWDSGPEPTPSW
DGPDKQSLVRRLLAVYALPSWGRAELALSLLQETPRNYELGDVVEAVRHSQDRAFLRRLL
AQECAVCGWALPHNRMQALTSCECTICPDCFRQHFTIALKEKHITDMVCPACGRPDLTDD
TQLLSYFSTLDIQLRESLEPDAYALFHKKLTEGVLMRDPKFLWCAQCSFGFIYEREQLEA
TCPQCHQTFCVRCKRQWEEQHRGRSCEDFQNWKRMNDPEYQAQGLAMYLQENGIDCPKCK
FSYALARGGCMHFHCTQCRHQFCSGCYNAFYAKNKCPEPNCRVKKSLHGHHPRDCLFYLR
DWTALRLQKLLQDNNVMFNTEPPAGARAVPGGGCRVIEQKEVPNGLRDEACGKETPAGYA
GLCQAHYKEYLVSLINAHSLDPATLYEVEELETATERYLHVRPQPLAGEDPPAYQARLLQ
KLTEEVPLGQSIPRRRK
Download sequence
Identical sequences H0YKX0
ENSP00000452972 ENSP00000452972

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]