SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000452988 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000452988
Domain Number 1 Region: 68-145
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000122
Family Ubiquitin-related 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000452988   Gene: ENSG00000054690   Transcript: ENST00000561370
Sequence length 182
Comment pep:known chromosome:GRCh37:14:68045280:68054265:1 gene:ENSG00000054690 transcript:ENST00000561370 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
XLFLPQHHFLWYVKQQLQRHADPRSETGQYATYCQRAVERTLRTGEREARPSRMEVVSIL
LRNPFHHSLPFSIPVHFTNGTYHVVGFDGSSTVDEFLQRLNQEIGMRKPSHSGFALFTDD
PSGRDLEHCLQGSVKICDAISKWEQAMKELHPGKSEGCTFAVKSKGRRTENGCSLPLKPV
ER
Download sequence
Identical sequences H0YKY5
ENSP00000452988 ENSP00000452988

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]