SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000453183 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000453183
Domain Number 1 Region: 4-166
Classification Level Classification E-value
Superfamily PLP-dependent transferases 4.47e-46
Family Pyridoxal-dependent decarboxylase 0.00000296
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000453183   Gene: ENSG00000140287   Transcript: ENST00000559683
Sequence length 178
Comment pep:putative chromosome:GRCh37:15:50546749:50555626:-1 gene:ENSG00000140287 transcript:ENST00000559683 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLLGREMVDYICQYLSTVRERRVTPDVQPGYLRAQLPESAPEDPDSWDSIFGDIERIIM
PGVVHWQSPHMHAYYPALTSWPSLLGDMLADAINCLGFTWASSPACTELEMNVMDWLAKM
LGLPEHFLHHHPSSQGGGVLQSTVSESTLIALLAARKNKILEMKTSEPDADESCLNAR
Download sequence
Identical sequences H0YLF0
ENSP00000453183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]